PTH analogEditorially reviewed · 30. Mai 2026

Teriparatid

Also known as Teriparatide, PTH(1-34), Forsteo et al.

prescription-onlyEvidence · clinically established2 studies cited

Structure · schematic

Peptide chain of 34 amino acids · PTH-Analog

Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Schematic representation of the amino acid chain — not a chemical structural formula. Each node represents one amino acid (shown truncated).

Research areas*

Recovery
Anti-aging

* Contexts in which the peptide has been scientifically studied — not assured or recommended effects.

§ 1

Mechanism of action

  • Teriparatide is the recombinant N-terminal fragment (1-34) of human parathyroid hormone (PTH).
  • It binds to the PTH-1 receptor on osteoblasts and osteocytes.
  • Unlike a persistently elevated PTH concentration (which promotes bone resorption), intermittent once-daily administration produces a predominantly anabolic effect on bone.
  • A stimulation of osteoblast activity and an increase in bone mass and structure have been described.
§ 2

Research status

  • Teriparatide is a clinically well-studied, approved osteoporosis medicine.
  • The pivotal trial (Neer et al., 2001) showed a significant reduction in vertebral and non-vertebral fractures versus placebo in postmenopausal women with osteoporosis.
  • Follow-up analyses documented a sustained reduction in fracture risk even after discontinuation.
  • Treatment duration is limited because of animal-model data (an osteosarcoma signal).

Evidence level

PreclinicalEarly clinicalEstablished
§ 3

Cited studies

  1. 2001
    Effect of parathyroid hormone (1-34) on fractures and bone mineral density in postmenopausal women with osteoporosis
  2. 2004
    Sustained vertebral fracture risk reduction after withdrawal of teriparatide in postmenopausal women with osteoporosis
§ 4

Known risks

  • 01Hypercalcaemia and hypercalciuria possible
  • 02Orthostatic hypotension, dizziness, especially at the start of treatment
  • 03Nausea, limb pain and headache described in studies
  • 04Osteosarcoma signal in long-term rat models — treatment duration limited
  • 05Contraindicated in bone malignancy, Paget's disease, pre-existing hypercalcaemia
§ 5

Frequently asked questions

What is Teriparatid?

Teriparatide is the recombinant N-terminal fragment (1-34) of human parathyroid hormone (PTH).

What type of peptide is Teriparatid?

Teriparatid belongs to the PTH analog class.

Is Teriparatid legal in Germany?

Teriparatid is prescription-only in Germany and may only be obtained with a medical prescription.

Where can I buy Teriparatid?

Peptica sells nothing and names no sources. Teriparatid is "prescription-only" in Germany; obtaining unapproved substances outside clinical studies is illegal and carries quality and safety risks.

Is Teriparatid banned in sport (WADA)?

Teriparatid is currently not on the WADA Prohibited List.

What are the known risks of Teriparatid?

Documented risks include: Hypercalcaemia and hypercalciuria possible; Orthostatic hypotension, dizziness, especially at the start of treatment. This is not a complete safety assessment and not medical advice — see the risks section for the full list.

How well researched is Teriparatid?

The evidence is classified as “clinically established”. 2 studies are cited on this page.

What is the molecular weight of Teriparatid?

Teriparatid has a molar mass of about 4117.8 Da, with a plasma half-life of ~1 hour (s.c.).

Which peptides are related to Teriparatid?

Closely related entries: Abaloparatid. A direct side-by-side comparison is available via the compare function.

Related entries

Legal status

Germany

prescription-only

Austria

prescription-only

Switzerland

prescription-only

EU

approved medicine

USA

prescription-only

Canada

prescription-only

Legal status varies by country and can change. This is not legal advice.

Sources & methodology

  • 2 peer-reviewed studies cited, linked to PubMed where available.
  • Molecular data verified against PubChem and primary literature. PubChem CID 16133850
  • Editorial standard: no dosage guidance, no sources, evidence level stated explicitly.

Last editorially reviewed: 30 May 2026

Important notice

This site is intended solely for factual, scientifically oriented information about peptides. It does not constitute medical advice, does not replace a consultation with a doctor and contains no recommendations for use in humans.

This site does not sell any substances and names no sources for unapproved substances. For medical questions, please consult qualified medical professionals.

Anzeige

Reserviert für sorgfältig ausgewählte Partner — Telemedizin, Diagnostik, legale topische Anwendungen.

§ 6

Community notes

Note: These posts are user opinions and not medical advice. Posts containing dosages, therapeutic claims or purchase recommendations are removed. All entries are manually reviewed before publication.